SCOP 1.75: Domain d3e9la1: 3e9l A:1760-2016

Lineage for d3e9la1 (3e9l A:1760-2016)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)

6. Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159640] (2 PDB entries)
   Uniprot Q6P2Q9 1760-2016! Uniprot Q6P2Q9 1771-1989

8. Domain d3e9la1: 3e9l A:1760-2016 [158068]
   complexed with cl, na

Details for d3e9la1

PDB Entry: 3e9l, 1.95 Å

PDB Description: Crystal Structure of Human Prp8, Residues 1755-2016

PDB Compounds: (A:) Pre-mRNA-processing-splicing factor 8

SCOP Domain Sequences for d3e9la1:

Sequence; same for both SEQRES and ATOM records:

>d3e9la1 c.55.3.14 (A:1760-2016) Pre-mRNA-splicing factor 8, Prp8 {Human (Homo sapiens) [TaxId: 9606]}
epylssqnygelfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlfl
kiihtsvwagqkrlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldf
pnivikgselqlpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlili
lralhvnndrakvilkpdkttitephhiwptltdeewikvevqlkdliladygkknnvnv
asltqseirdiilgmei

Timeline for d3e9la1:

• d3e9la1 is new in SCOP 1.75
  
• d3e9la1 appears in SCOPe 2.01
  
• d3e9la1 appears in the current release, SCOPe 2.08