Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) consists of one domain of this fold |
Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein) |
Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [159640] (2 PDB entries) Uniprot Q6P2Q9 1760-2016! Uniprot Q6P2Q9 1771-1989 |
Domain d3e9la1: 3e9l A:1760-2016 [158068] complexed with cl, na |
PDB Entry: 3e9l (more details), 1.95 Å
SCOP Domain Sequences for d3e9la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e9la1 c.55.3.14 (A:1760-2016) Pre-mRNA-splicing factor 8, Prp8 {Human (Homo sapiens) [TaxId: 9606]} epylssqnygelfsnqiiwfvddtnvyrvtihktfegnlttkpingaififnprtgqlfl kiihtsvwagqkrlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldf pnivikgselqlpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlili lralhvnndrakvilkpdkttitephhiwptltdeewikvevqlkdliladygkknnvnv asltqseirdiilgmei
Timeline for d3e9la1: