Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Pkb kinase (Akt-2) [82791] (1 species) AGC group; RAC/Akt subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [82792] (16 PDB entries) |
Domain d3e8db_: 3e8d B: [158064] automated match to d1o6ka_ complexed with g98 |
PDB Entry: 3e8d (more details), 2.7 Å
SCOPe Domain Sequences for d3e8db_:
Sequence, based on SEQRES records: (download)
>d3e8db_ d.144.1.7 (B:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta qsititppdrydslglleldqrthfpqfdysasir
>d3e8db_ d.144.1.7 (B:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta qsiqrthfpqfdysasir
Timeline for d3e8db_: