Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Pkb kinase (Akt-2) [82791] (1 species) AGC group; RAC/Akt subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [82792] (14 PDB entries) |
Domain d3e88b1: 3e88 B:146-479 [158062] automatically matched to d1o6ka_ complexed with g96; mutant |
PDB Entry: 3e88 (more details), 2.5 Å
SCOP Domain Sequences for d3e88b1:
Sequence, based on SEQRES records: (download)
>d3e88b1 d.144.1.7 (B:146-479) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta qsititppdrydslglleldqrthfpqfdysasi
>d3e88b1 d.144.1.7 (B:146-479) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta qsititqrthfpqfdysasi
Timeline for d3e88b1: