SCOPe 2.07: Domain d1c6sa_: 1c6s A:

Lineage for d1c6sa_ (1c6s A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)

7. Species Synechococcus elongatus [TaxId:32046] [46634] (1 PDB entry)

8. Domain d1c6sa_: 1c6s A: [15806]
   complexed with hec

Details for d1c6sa_

PDB Entry: 1c6s

PDB Description: the solution structure of cytochrome c6 from the thermophilic cyanobacterium synechococcus elongatus, nmr, 20 structures

PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d1c6sa_:

Sequence; same for both SEQRES and ATOM records:

>d1c6sa_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Synechococcus elongatus [TaxId: 32046]}
adlangakvfsgncaachmgggnvvmanktlkkealeqfgmysedaiiyqvqhgknampa
fagrltdeqiqdvaayvldqaakgwag

Timeline for d1c6sa_:

• d1c6sa_ first appeared (with stable ids) in SCOP 1.55, called d1c6s__
  
• d1c6sa_ appears in SCOPe 2.06
  
• d1c6sa_ appears in the current release, SCOPe 2.08