Lineage for d1c6s__ (1c6s -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (7 species) 
Species Cyanobacterium (Synechococcus elongatus) [TaxId:32046] [46634] (1 PDB entry) 
Domain d1c6s__: 1c6s - [15806]
Details for d1c6s__
PDB Entry: 1c6s (more details)
PDB Description: the solution structure of cytochrome c6 from the thermophilic cyanobacterium synechococcus elongatus, nmr, 20 structures
SCOP Domain Sequences for d1c6s__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c6s__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Cyanobacterium (Synechococcus elongatus)}
adlangakvfsgncaachmgggnvvmanktlkkealeqfgmysedaiiyqvqhgknampa
fagrltdeqiqdvaayvldqaakgwag
SCOP Domain Coordinates for d1c6s__:
Click to download the PDB-style file with coordinates for d1c6s__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c6s__:
- d1c6s__ appears in SCOP 1.57
- d1c6s__ appears in the current release, SCOPe 2.08, called d1c6sa_
View in 3D