Lineage for d1cyj__ (1cyj -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (7 species) 
Species Chlamydomonas reinhardtii [TaxId:3055] [46633] (2 PDB entries) 
Domain d1cyj__: 1cyj - [15805]
Details for d1cyj__
PDB Entry: 1cyj (more details), 1.9 Å
PDB Description: cytochrome c6
SCOP Domain Sequences for d1cyj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyj__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Chlamydomonas reinhardtii}
adlalgaqvfngncaachmggrnsvmpektldkaaleqyldggfkvesiiyqvengkgam
pawadrlseeeiqavaeyvfkqatdaawky
SCOP Domain Coordinates for d1cyj__:
Click to download the PDB-style file with coordinates for d1cyj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cyj__:
- d1cyj__ appears in SCOP 1.57
- d1cyj__ appears in the current release, SCOPe 2.08, called d1cyja_
View in 3D