SCOPe 2.07: Domain d2dvha_: 2dvh A:

Lineage for d2dvha_ (2dvh A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [46632] (1 PDB entry)

8. Domain d2dvha_: 2dvh A: [15803]
   complexed with hec; mutant

Details for d2dvha_

PDB Entry: 2dvh

PDB Description: the y64a mutant of cytochrome c553 from desulfovibrio vulgaris hildenborough, nmr, 39 structures

PDB Compounds: (A:) cytochrome c-553

SCOPe Domain Sequences for d2dvha_:

Sequence; same for both SEQRES and ATOM records:

>d2dvha_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Desulfovibrio desulfuricans [TaxId: 876]}
adgaalykscigchgadgskaamgsakpvkgqgaeelykkmkgyadgsyggerkammtna
vkkasdeelkaladymskl

Timeline for d2dvha_:

• d2dvha_ first appeared (with stable ids) in SCOP 1.55, called d2dvh__
  
• d2dvha_ appears in SCOPe 2.06
  
• d2dvha_ appears in the current release, SCOPe 2.08