SCOPe 2.07: Domain d1c53a_: 1c53 A:

Lineage for d1c53a_ (1c53 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)

7. Species Desulfovibrio vulgaris, different strains [TaxId:881] [46631] (2 PDB entries)

8. Domain d1c53a_: 1c53 A: [15801]
   complexed with hem

Details for d1c53a_

PDB Entry: 1c53, 1.8 Å

PDB Description: s-class cytochromes c have a variety of folding patterns: structure of cytochrome c-553 from desulfovibrio vulgaris determined by the multi-wavelength anomalous dispersion method

PDB Compounds: (A:) cytochrome c553

SCOPe Domain Sequences for d1c53a_:

Sequence; same for both SEQRES and ATOM records:

>d1c53a_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Desulfovibrio vulgaris, different strains [TaxId: 881]}
adgaalykscvgchgadgskqamgvghavkgqkadelfkklkgyadgsyggekkavmtnl
vkrysdeemkamadymskl

Timeline for d1c53a_:

• d1c53a_ first appeared (with stable ids) in SCOP 1.55, called d1c53__
  
• d1c53a_ appears in SCOPe 2.06
  
• d1c53a_ appears in the current release, SCOPe 2.08