SCOPe 2.07: Domain d1a2sa_: 1a2s A:

Lineage for d1a2sa_ (1a2s A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)

7. Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries)

8. Domain d1a2sa_: 1a2s A: [15800]
   complexed with hec

Details for d1a2sa_

PDB Entry: 1a2s

PDB Description: the solution nmr structure of oxidized cytochrome c6 from the green alga monoraphidium braunii, minimized average structure

PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d1a2sa_:

Sequence; same for both SEQRES and ATOM records:

>d1a2sa_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii [TaxId: 34112]}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw

Timeline for d1a2sa_:

• d1a2sa_ first appeared (with stable ids) in SCOP 1.55, called d1a2s__
  
• d1a2sa_ appears in SCOPe 2.06
  
• d1a2sa_ appears in the current release, SCOPe 2.08