Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species) |
Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries) |
Domain d1a2sa_: 1a2s A: [15800] complexed with hec |
PDB Entry: 1a2s (more details)
SCOPe Domain Sequences for d1a2sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2sa_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii [TaxId: 34112]} eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga mpawdgrldedeiagvaayvydqaagnkw
Timeline for d1a2sa_: