Lineage for d1a2sa_ (1a2s A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690984Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)
  7. 2691016Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries)
  8. 2691019Domain d1a2sa_: 1a2s A: [15800]
    complexed with hec

Details for d1a2sa_

PDB Entry: 1a2s (more details)

PDB Description: the solution nmr structure of oxidized cytochrome c6 from the green alga monoraphidium braunii, minimized average structure
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d1a2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2sa_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii [TaxId: 34112]}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw

SCOPe Domain Coordinates for d1a2sa_:

Click to download the PDB-style file with coordinates for d1a2sa_.
(The format of our PDB-style files is described here.)

Timeline for d1a2sa_: