SCOP 1.75: Domain d1ceda_: 1ced A:

Lineage for d1ceda_ (1ced A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)

7. Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries)

8. Domain d1ceda_: 1ced A: [15799]
   complexed with hem

Details for d1ceda_

PDB Entry: 1ced

PDB Description: the structure of cytochrome c6 from monoraphidium braunii, nmr, minimized average structure

PDB Compounds: (A:) cytochrome c6

SCOP Domain Sequences for d1ceda_:

Sequence; same for both SEQRES and ATOM records:

>d1ceda_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii [TaxId: 34112]}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw

Timeline for d1ceda_:

• d1ceda_ first appeared (with stable ids) in SCOP 1.55, called d1ced__
  
• d1ceda_ appears in SCOP 1.73
  
• d1ceda_ appears in SCOPe 2.01
  
• d1ceda_ appears in the current release, SCOPe 2.08