Lineage for d3e2ma1 (3e2m A:128-309)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839328Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 839329Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 839330Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 839389Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 839390Species Human (Homo sapiens) [TaxId:9606] [53303] (19 PDB entries)
    Uniprot P20701 153-334
  8. 839410Domain d3e2ma1: 3e2m A:128-309 [157989]
    automatically matched to d1dgqa_
    complexed with e2m

Details for d3e2ma1

PDB Entry: 3e2m (more details), 2 Å

PDB Description: LFA-1 I domain bound to inhibitors
PDB Compounds: (A:) Integrin alpha-L

SCOP Domain Sequences for d3e2ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e2ma1 c.62.1.1 (A:128-309) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vi

SCOP Domain Coordinates for d3e2ma1:

Click to download the PDB-style file with coordinates for d3e2ma1.
(The format of our PDB-style files is described here.)

Timeline for d3e2ma1: