Lineage for d3e1kk2 (3e1k K:155-373)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 866361Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 866362Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 866829Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 866830Protein Galactose/lactose metabolism regulatory protein GAL80 [143546] (1 species)
  7. 866831Species Yeast (Kluyveromyces lactis) [TaxId:28985] [143547] (2 PDB entries)
    Uniprot Q06433 155-373
  8. 866838Domain d3e1kk2: 3e1k K:155-373 [157982]
    Other proteins in same PDB: d3e1ka1, d3e1kc1, d3e1ke1, d3e1kg1, d3e1ki1, d3e1kk1, d3e1km1, d3e1ko1
    automatically matched to d2nvwa2

Details for d3e1kk2

PDB Entry: 3e1k (more details), 3 Å

PDB Description: crystal structure of kluyveromyces lactis gal80p in complex with the acidic activation domain of gal4p
PDB Compounds: (K:) Galactose/lactose metabolism regulatory protein GAL80

SCOP Domain Sequences for d3e1kk2:

Sequence, based on SEQRES records: (download)

>d3e1kk2 d.81.1.5 (K:155-373) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]}
kspyivrakelisegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfgh
tidvlqyitgsyfqkinamisnniptqflldengkrtketisktcpdhllfqgilengkv
pvscsfkggtpvkkltknlvidihgtkgdlkiegdagfveisnlvlyfygikngngssng
tdnngaaaikdkekvtkspspstgtseeeqtmevfhlrn

Sequence, based on observed residues (ATOM records): (download)

>d3e1kk2 d.81.1.5 (K:155-373) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]}
kspyivrakelisegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfgh
tidvlqyitgsyfqkinamisnniptqflldengkrtketisktcpdhllfqgilengkv
pvscsfkggtpvkkltknlvidihgtkgdlkiegdagfveisnlvlyfygikngeeqtme
vfhlrn

SCOP Domain Coordinates for d3e1kk2:

Click to download the PDB-style file with coordinates for d3e1kk2.
(The format of our PDB-style files is described here.)

Timeline for d3e1kk2: