Lineage for d1ctj__ (1ctj -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (7 species) 
Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries) 
Domain d1ctj__: 1ctj - [15798]
Details for d1ctj__
PDB Entry: 1ctj (more details), 1.1 Å
PDB Description: crystal structure of cytochrome c6
SCOP Domain Sequences for d1ctj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ctj__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw
SCOP Domain Coordinates for d1ctj__:
Click to download the PDB-style file with coordinates for d1ctj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ctj__:
- d1ctj__ appears in SCOP 1.57
- d1ctj__ appears in the current release, SCOPe 2.08, called d1ctja_
View in 3D