Lineage for d3e11b_ (3e11 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212822Family d.92.1.17: TTHA0227-like [160555] (2 proteins)
    PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures
  6. 1212823Protein Uncharacterized protein Acel_2062 [160558] (1 species)
  7. 1212824Species Acidothermus cellulolyticus [TaxId:28049] [160559] (1 PDB entry)
    Uniprot A0LWM4 1-113
  8. 1212826Domain d3e11b_: 3e11 B: [157970]
    automated match to d3e11a1
    complexed with act, ca

Details for d3e11b_

PDB Entry: 3e11 (more details), 1.8 Å

PDB Description: crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution
PDB Compounds: (B:) predicted zincin-like metalloprotease

SCOPe Domain Sequences for d3e11b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e11b_ d.92.1.17 (B:) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]}
gmvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgipltertta
yggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy

SCOPe Domain Coordinates for d3e11b_:

Click to download the PDB-style file with coordinates for d3e11b_.
(The format of our PDB-style files is described here.)

Timeline for d3e11b_: