Lineage for d3e11b1 (3e11 B:1-113)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 868193Family d.92.1.17: TTHA0227-like [160555] (2 proteins)
    PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures
  6. 868194Protein Uncharacterized protein Acel_2062 [160558] (1 species)
  7. 868195Species Acidothermus cellulolyticus [TaxId:28049] [160559] (1 PDB entry)
    Uniprot A0LWM4 1-113
  8. 868197Domain d3e11b1: 3e11 B:1-113 [157970]
    automatically matched to 3E11 A:1-113
    complexed with act, ca

Details for d3e11b1

PDB Entry: 3e11 (more details), 1.8 Å

PDB Description: crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution
PDB Compounds: (B:) predicted zincin-like metalloprotease

SCOP Domain Sequences for d3e11b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e11b1 d.92.1.17 (B:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]}
mvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgiplterttay
ggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy

SCOP Domain Coordinates for d3e11b1:

Click to download the PDB-style file with coordinates for d3e11b1.
(The format of our PDB-style files is described here.)

Timeline for d3e11b1: