![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.17: TTHA0227-like [160555] (2 proteins) Pfam PFPF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures Pfam PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures |
![]() | Protein Uncharacterized protein Acel_2062 [160558] (1 species) |
![]() | Species Acidothermus cellulolyticus [TaxId:28049] [160559] (1 PDB entry) Uniprot A0LWM4 1-113 |
![]() | Domain d3e11b2: 3e11 B:1-113 [157970] Other proteins in same PDB: d3e11a2, d3e11b3 automated match to d3e11a1 complexed with act, ca |
PDB Entry: 3e11 (more details), 1.8 Å
SCOPe Domain Sequences for d3e11b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e11b2 d.92.1.17 (B:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]} mvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgiplterttay ggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy
Timeline for d3e11b2: