Lineage for d1b7va_ (1b7v A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304440Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)
  7. 2304451Species Bacillus pasteurii [TaxId:1474] [46629] (5 PDB entries)
  8. 2304453Domain d1b7va_: 1b7v A: [15797]
    complexed with hem

Details for d1b7va_

PDB Entry: 1b7v (more details), 1.7 Å

PDB Description: structure of the c-553 cytochrome from bacillus pasteruii to 1.7 a resolution
PDB Compounds: (A:) protein (cytochrome c-553)

SCOPe Domain Sequences for d1b7va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7va_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Bacillus pasteurii [TaxId: 1474]}
vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
eavaawlaekk

SCOPe Domain Coordinates for d1b7va_:

Click to download the PDB-style file with coordinates for d1b7va_.
(The format of our PDB-style files is described here.)

Timeline for d1b7va_: