Lineage for d3e0va2 (3e0v A:1-87,A:187-357)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824470Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1824471Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 1824472Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 1824560Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51626] (11 PDB entries)
  8. 1824602Domain d3e0va2: 3e0v A:1-87,A:187-357 [157949]
    Other proteins in same PDB: d3e0va1, d3e0va3, d3e0vb1, d3e0vb3, d3e0vc1, d3e0vc3, d3e0vd1, d3e0vd3, d3e0ve1, d3e0ve3, d3e0vf1, d3e0vf3
    automatically matched to d1pkla2
    complexed with gol, so4

Details for d3e0va2

PDB Entry: 3e0v (more details), 3.3 Å

PDB Description: crystal structure of pyruvate kinase from leishmania mexicana in complex with sulphate ions
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d3e0va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e0va2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
qttinnvrqaaaelgvniaialdtkgpXpavsakdrvdlqfgveqgvdmifasfirsaeq
vgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvvaq
kiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgky
pnevvqymaricleaqsal

SCOPe Domain Coordinates for d3e0va2:

Click to download the PDB-style file with coordinates for d3e0va2.
(The format of our PDB-style files is described here.)

Timeline for d3e0va2: