Lineage for d3dyla_ (3dyl A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927815Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 927816Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 927893Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 928039Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (1 species)
  7. 928040Species Human (Homo sapiens) [TaxId:9606] [109943] (11 PDB entries)
    Uniprot O76083 241-566
  8. 928053Domain d3dyla_: 3dyl A: [157940]
    automated match to d2hd1a1
    complexed with fmt, ibm, mg, mn, pcg

Details for d3dyla_

PDB Entry: 3dyl (more details), 2.7 Å

PDB Description: human phosphdiesterase 9 substrate complex (ES complex)
PDB Compounds: (A:) human phosphodiesterase 9

SCOPe Domain Sequences for d3dyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dyla_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
gshmtypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrr
wlfcvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhp
gynntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmi
tlilatdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwv
dclleeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmvee
imlqplwesrdryeelkriddamkelqk

SCOPe Domain Coordinates for d3dyla_:

Click to download the PDB-style file with coordinates for d3dyla_.
(The format of our PDB-style files is described here.)

Timeline for d3dyla_: