Lineage for d3dwya1 (3dwy A:1084-1197)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767486Superfamily a.29.2: Bromodomain [47370] (1 family) (S)
  5. 767487Family a.29.2.1: Bromodomain [47371] (4 proteins)
  6. 767488Protein CREB-binding protein, CBP [74712] (1 species)
  7. 767489Species Human (Homo sapiens) [TaxId:9606] [74713] (4 PDB entries)
  8. 767490Domain d3dwya1: 3dwy A:1084-1197 [157925]
    automatically matched to d1jspb_
    complexed with edo

Details for d3dwya1

PDB Entry: 3dwy (more details), 1.98 Å

PDB Description: crystal structure of the bromodomain of human crebbp
PDB Compounds: (A:) creb-binding protein

SCOP Domain Sequences for d3dwya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOP Domain Coordinates for d3dwya1:

Click to download the PDB-style file with coordinates for d3dwya1.
(The format of our PDB-style files is described here.)

Timeline for d3dwya1: