Lineage for d3dwha_ (3dwh A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1142195Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1142196Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1142402Family b.122.1.12: SRA domain-like [159368] (2 proteins)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 1142403Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 1142404Species Human (Homo sapiens) [TaxId:9606] [159370] (4 PDB entries)
    Uniprot Q96T88 409-615! Uniprot Q96T88 414-617
  8. 1142407Domain d3dwha_: 3dwh A: [157912]
    automated match to d3bi7a1
    complexed with gol, so4

Details for d3dwha_

PDB Entry: 3dwh (more details), 1.95 Å

PDB Description: Structural and Functional Analysis of SRA domain
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3dwha_:

Sequence, based on SEQRES records: (download)

>d3dwha_ b.122.1.12 (A:) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
gshmpsnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyedd
vdhgnfftytgsggrdlsgnkrtaeqscdqkltntnralalncfapindqegaeakdwrs
gkpvrvvrnvkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgp
wtkegkdrikklgltmqypegylea

Sequence, based on observed residues (ATOM records): (download)

>d3dwha_ b.122.1.12 (A:) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
gshmpsnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyedd
vdhgnfftytgsggscdqkltntnralalncfapindqegaeakdwrsgkpvrvvrnvkg
gknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtkegkdrikkl
gltmqypegylea

SCOPe Domain Coordinates for d3dwha_:

Click to download the PDB-style file with coordinates for d3dwha_.
(The format of our PDB-style files is described here.)

Timeline for d3dwha_: