Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (126 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d3dvnv_: 3dvn V: [157903] Other proteins in same PDB: d3dvna1, d3dvna2, d3dvnb1, d3dvnb2, d3dvnh1, d3dvnh2, d3dvnl1, d3dvnl2 automated match to d1aara_ |
PDB Entry: 3dvn (more details), 2.7 Å
SCOPe Domain Sequences for d3dvnv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dvnv_ d.15.1.1 (V:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqrestlhlvlrlrgg
Timeline for d3dvnv_: