SCOPe 2.04: Domain d3dvnl2: 3dvn L:110-214

Lineage for d3dvnl2 (3dvn L:110-214)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d3dvnl2: 3dvn L:110-214 [157901]
Other proteins in same PDB: d3dvna1, d3dvnb1, d3dvnb2, d3dvnh1, d3dvnh2, d3dvnl1, d3dvnu_, d3dvnv_, d3dvnx_, d3dvny_
automatically matched to d1g9ml2

Details for d3dvnl2

PDB Entry: 3dvn (more details), 2.7 Å

PDB Description: crystal structure of k63-specific fab apu2.16 bound to k63-linked di- ubiquitin

PDB Compounds: (L:) Human IgG1 fab fragment light chain

SCOPe Domain Sequences for d3dvnl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvnl2 b.1.1.2 (L:110-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d3dvnl2:

Click to download the PDB-style file with coordinates for d3dvnl2.
(The format of our PDB-style files is described here.)

Timeline for d3dvnl2: