Lineage for d3dvgb2 (3dvg B:121-221)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760578Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1760582Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1760736Domain d3dvgb2: 3dvg B:121-221 [157891]
    Other proteins in same PDB: d3dvga1, d3dvga2, d3dvgb1, d3dvgx_, d3dvgy_
    automatically matched to d1ngzb2

Details for d3dvgb2

PDB Entry: 3dvg (more details), 2.6 Å

PDB Description: crystal structure of k63-specific fab apu.3a8 bound to k63-linked di- ubiquitin
PDB Compounds: (B:) Human IgG1 fab fragment heavy chain

SCOPe Domain Sequences for d3dvgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvgb2 b.1.1.2 (B:121-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d3dvgb2:

Click to download the PDB-style file with coordinates for d3dvgb2.
(The format of our PDB-style files is described here.)

Timeline for d3dvgb2: