SCOPe 2.08: Domain d3dvga1: 3dvg A:5-109

Lineage for d3dvga1 (3dvg A:5-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)

8. Domain d3dvga1: 3dvg A:5-109 [157888]
   Other proteins in same PDB: d3dvga2, d3dvgb1, d3dvgb2, d3dvgx2, d3dvgx3, d3dvgy_
   automatically matched to d1g9ml1

Details for d3dvga1

PDB Entry: 3dvg, 2.6 Å

PDB Description: crystal structure of k63-specific fab apu.3a8 bound to k63-linked di- ubiquitin

PDB Compounds: (A:) Human IgG1 fab fragment light chain

SCOPe Domain Sequences for d3dvga1:

Sequence; same for both SEQRES and ATOM records:

>d3dvga1 b.1.1.1 (A:5-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysarslysgvpsrfsg
srsgtdftltisslqpedfatyycqqyssysslftfgqgtkveik

Timeline for d3dvga1:

• d3dvga1 first appeared in SCOP 1.75
  
• d3dvga1 appears in SCOPe 2.07