Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries) |
Domain d3duhb3: 3duh B:212-305 [157887] Other proteins in same PDB: d3duha1, d3duhb1 automatically matched to d1f42a3 complexed with nag |
PDB Entry: 3duh (more details), 2.3 Å
SCOPe Domain Sequences for d3duhb3:
Sequence, based on SEQRES records: (download)
>d3duhb3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk tsatvicrknasisvraqdryyssswsewasvpc
>d3duhb3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} kpdppknlqlkplqvevsweypdtwstphsyfsltfcvqvqgkkkdrvftdktsatvicr knasisvraqdryyssswsewasvpc
Timeline for d3duhb3: