SCOP 1.75: Domain d3dtud2: 3dtu D:30-129

Lineage for d3dtud2 (3dtu D:30-129)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81457] (4 PDB entries)

8. Domain d3dtud2: 3dtu D:30-129 [157861]
   Other proteins in same PDB: d3dtua1, d3dtub1, d3dtuc1, d3dtud1
   automatically matched to d1m56b2
   complexed with ca, cd, cu, dmu, dxc, hea, hto, mg, oh, po4, trd

Details for d3dtud2

PDB Entry: 3dtu, 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides complexed with deoxycholic acid

PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d3dtud2:

Sequence; same for both SEQRES and ATOM records:

>d3dtud2 f.17.2.1 (D:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

Timeline for d3dtud2:

• d3dtud2 is new in SCOP 1.75
  
• d3dtud2 appears in SCOPe 2.01
  
• d3dtud2 appears in the current release, SCOPe 2.08