![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins) |
![]() | Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81457] (4 PDB entries) |
![]() | Domain d3dtud2: 3dtu D:30-129 [157861] Other proteins in same PDB: d3dtua1, d3dtub1, d3dtuc1, d3dtud1 automatically matched to d1m56b2 complexed with ca, cd, cu, dmu, dxc, hea, hto, mg, oh, po4, trd |
PDB Entry: 3dtu (more details), 2.15 Å
SCOP Domain Sequences for d3dtud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dtud2 f.17.2.1 (D:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]} leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk vparfthnspleiawtivpivilvaigafslpvlfnqqei
Timeline for d3dtud2:
![]() Domains from other chains: (mouse over for more information) d3dtua1, d3dtub1, d3dtub2, d3dtuc1 |