SCOP 1.75: Domain d3dtud1: 3dtu D:130-281

Lineage for d3dtud1 (3dtu D:130-281)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [74870] (4 PDB entries)

8. Domain d3dtud1: 3dtu D:130-281 [157860]
   Other proteins in same PDB: d3dtua1, d3dtub2, d3dtuc1, d3dtud2
   automatically matched to d1m56b1
   complexed with ca, cd, cu, dmu, dxc, hea, hto, mg, oh, po4, trd

Details for d3dtud1

PDB Entry: 3dtu, 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides complexed with deoxycholic acid

PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d3dtud1:

Sequence; same for both SEQRES and ATOM records:

>d3dtud1 b.6.1.2 (D:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

Timeline for d3dtud1:

• d3dtud1 is new in SCOP 1.75
  
• d3dtud1 appears in SCOPe 2.01
  
• d3dtud1 appears in the current release, SCOPe 2.08