![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
![]() | Protein Cytochrome c oxidase [49544] (4 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [74870] (6 PDB entries) |
![]() | Domain d3dtub1: 3dtu B:130-287 [157857] Other proteins in same PDB: d3dtua_, d3dtub2, d3dtuc_, d3dtud2 automated match to d3fyeb2 complexed with ca, cd, cu, dmu, dxc, hea, hto, mg, oh, po4, trd |
PDB Entry: 3dtu (more details), 2.15 Å
SCOPe Domain Sequences for d3dtub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dtub1 b.6.1.2 (B:130-287) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]} peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff gqcselcgishaympitvkvvseeayaawleqhhhhhh
Timeline for d3dtub1:
![]() Domains from other chains: (mouse over for more information) d3dtua_, d3dtuc_, d3dtud1, d3dtud2 |