SCOPe 2.06: Domain d3dtpc1: 3dtp C:3-150

Lineage for d3dtpc1 (3dtp C:3-150)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Essential Chain [47524] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47526] (4 PDB entries)

8. Domain d3dtpc1: 3dtp C:3-150 [157854]
   automatically matched to d1br1b_

Details for d3dtpc1

PDB Entry: 3dtp, 20 Å

PDB Description: tarantula heavy meromyosin obtained by flexible docking to tarantula muscle thick filament cryo-em 3d-map

PDB Compounds: (C:) Smooth muscle myosin essential light chain

SCOPe Domain Sequences for d3dtpc1:

Sequence; same for both SEQRES and ATOM records:

>d3dtpc1 a.39.1.5 (C:3-150) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}
fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
eveqlvaghedsngcinyeelvrmvlsg

Timeline for d3dtpc1:

• d3dtpc1 first appeared in SCOP 1.75
  
• d3dtpc1 appears in SCOPe 2.05
  
• d3dtpc1 appears in SCOPe 2.07
  
• d3dtpc1 appears in the current release, SCOPe 2.08