Lineage for d3dsub1 (3dsu B:7-331)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774411Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 774536Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 774638Protein Rab geranylgeranyltransferase, beta subunit [48249] (1 species)
  7. 774639Species Rat (Rattus norvegicus) [TaxId:10116] [48250] (9 PDB entries)
  8. 774642Domain d3dsub1: 3dsu B:7-331 [157843]
    automatically matched to d1dceb_
    complexed with ca, fpp, zn

Details for d3dsub1

PDB Entry: 3dsu (more details), 1.9 Å

PDB Description: crystal structure of rabggtase(delta lrr; delta ig)in complex with farnesyl pyrophosphate
PDB Compounds: (B:) Geranylgeranyl transferase type-2 subunit beta

SCOP Domain Sequences for d3dsub1:

Sequence, based on SEQRES records: (download)

>d3dsub1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
dvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmgqlhrm
nkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqsl
qkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpg
seshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvl
aslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqi
kpvspvfcmpeevlqrvnvqpelvs

Sequence, based on observed residues (ATOM records): (download)

>d3dsub1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
dvtiksdapdtlllekhadyiasygskkyeycmseylrmsgvywgltvmdlmgqlhrmnk
eeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslqk
edgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgse
shagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvlas
lkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqikp
vspvfcmpeevlqrvnvqpelvs

SCOP Domain Coordinates for d3dsub1:

Click to download the PDB-style file with coordinates for d3dsub1.
(The format of our PDB-style files is described here.)

Timeline for d3dsub1: