Lineage for d3dqvy_ (3dqv Y:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264067Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2264068Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2264069Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2264102Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 2264103Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
    Uniprot P62877 19-106
  8. 2264108Domain d3dqvy_: 3dqv Y: [157829]
    Other proteins in same PDB: d3dqva2, d3dqva3, d3dqvb1, d3dqvb2
    automated match to d3dplr_
    complexed with zn

Details for d3dqvy_

PDB Entry: 3dqv (more details), 3 Å

PDB Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation
PDB Compounds: (Y:) Rbx1

SCOPe Domain Sequences for d3dqvy_:

Sequence, based on SEQRES records: (download)

>d3dqvy_ g.44.1.1 (Y:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqk

Sequence, based on observed residues (ATOM records): (download)

>d3dqvy_ g.44.1.1 (Y:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimciecqanqasatseectvawgvcnhafh
fhcisrwlktrqvcpldnrewefqk

SCOPe Domain Coordinates for d3dqvy_:

Click to download the PDB-style file with coordinates for d3dqvy_.
(The format of our PDB-style files is described here.)

Timeline for d3dqvy_: