SCOPe 2.03: Domain d3dqvy1: 3dqv Y:19-105

Lineage for d3dqvy1 (3dqv Y:19-105)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)

6. Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75694] (6 PDB entries)
   Uniprot P62877 19-106

8. Domain d3dqvy1: 3dqv Y:19-105 [157829]
   Other proteins in same PDB: d3dqva1
   automatically matched to d1ldjb_
   complexed with zn

Details for d3dqvy1

PDB Entry: 3dqv, 3 Å

PDB Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation

PDB Compounds: (Y:) Rbx1

SCOPe Domain Sequences for d3dqvy1:

Sequence, based on SEQRES records:

>d3dqvy1 g.44.1.1 (Y:19-105) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqk

Sequence, based on observed residues (ATOM records):

>d3dqvy1 g.44.1.1 (Y:19-105) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimciecqanqasatseectvawgvcnhafh
fhcisrwlktrqvcpldnrewefqk

Timeline for d3dqvy1:

• d3dqvy1 first appeared in SCOP 1.75
  
• d3dqvy1 appears in SCOPe 2.02
  
• d3dqvy1 is called d3dqvy_ in SCOPe 2.04
  
• d3dqvy1 appears in the current release, SCOPe 2.08, called d3dqvy_