Lineage for d3dqvr_ (3dqv R:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588606Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2588607Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2588608Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2588641Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 2588642Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
    Uniprot P62877 19-106
  8. 2588646Domain d3dqvr_: 3dqv R: [157828]
    Other proteins in same PDB: d3dqva2, d3dqva3, d3dqvb1, d3dqvb2
    automated match to d3dplr_
    complexed with zn

Details for d3dqvr_

PDB Entry: 3dqv (more details), 3 Å

PDB Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation
PDB Compounds: (R:) Rbx1

SCOPe Domain Sequences for d3dqvr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dqvr_ g.44.1.1 (R:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
krfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnhaf
hfhcisrwlktrqvcpldnrewefqk

SCOPe Domain Coordinates for d3dqvr_:

Click to download the PDB-style file with coordinates for d3dqvr_.
(The format of our PDB-style files is described here.)

Timeline for d3dqvr_: