Lineage for d3dqva1 (3dqv A:103-171)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1195091Protein automated matches [190118] (8 species)
    not a true protein
  7. 1195101Species Human (Homo sapiens) [TaxId:9606] [189560] (37 PDB entries)
  8. 1195165Domain d3dqva1: 3dqv A:103-171 [157827]
    Other proteins in same PDB: d3dqvr1, d3dqvy1
    automatically matched to d1yiwa1
    complexed with zn

Details for d3dqva1

PDB Entry: 3dqv (more details), 3 Å

PDB Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation
PDB Compounds: (A:) nedd8

SCOPe Domain Sequences for d3dqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dqva1 d.15.1.1 (A:103-171) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadykim
ggsvlhlvl

SCOPe Domain Coordinates for d3dqva1:

Click to download the PDB-style file with coordinates for d3dqva1.
(The format of our PDB-style files is described here.)

Timeline for d3dqva1: