Lineage for d3dogd1 (3dog D:171-309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718091Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries)
  8. 2718116Domain d3dogd1: 3dog D:171-309 [157817]
    Other proteins in same PDB: d3doga1, d3doga2, d3dogc1, d3dogc2, d3dogd3
    automated match to d1finb1
    complexed with nnn, sgm

Details for d3dogd1

PDB Entry: 3dog (more details), 2.7 Å

PDB Description: Structure of Thr 160 phosphorylated CDK2/cyclin A in complex with the inhibitor N-&-N1
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d3dogd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dogd1 a.74.1.1 (D:171-309) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
vlrmehlvlkvlafdlaap

SCOPe Domain Coordinates for d3dogd1:

Click to download the PDB-style file with coordinates for d3dogd1.
(The format of our PDB-style files is described here.)

Timeline for d3dogd1: