SCOPe 2.04: Domain d3dogb1: 3dog B:171-309

Lineage for d3dogb1 (3dog B:171-309)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries)

8. Domain d3dogb1: 3dog B:171-309 [157815]
   Other proteins in same PDB: d3doga_, d3dogc_
   automated match to d1finb1
   complexed with nnn, sgm

Details for d3dogb1

PDB Entry: 3dog, 2.7 Å

PDB Description: Structure of Thr 160 phosphorylated CDK2/cyclin A in complex with the inhibitor N-&-N1

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3dogb1:

Sequence; same for both SEQRES and ATOM records:

>d3dogb1 a.74.1.1 (B:171-309) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
svnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqne
tlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkq
vlrmehlvlkvlafdlaap

Timeline for d3dogb1:

• d3dogb1 first appeared in SCOP 1.75
  
• d3dogb1 appears in SCOPe 2.03
  
• d3dogb1 appears in SCOPe 2.05
  
• d3dogb1 appears in the current release, SCOPe 2.08