Lineage for d3dllw1 (3dll W:1-55)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956419Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 2956420Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 2956421Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 2956464Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 2956465Species Deinococcus radiodurans [TaxId:1299] [160396] (6 PDB entries)
    Uniprot Q9RSL0 1-55
  8. 2956468Domain d3dllw1: 3dll W:1-55 [157800]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dlly1
    automatically matched to 2ZJR W:1-55
    complexed with mg, zld, zn

Details for d3dllw1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (W:) 50S ribosomal protein L30

SCOPe Domain Sequences for d3dllw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllw1 d.59.1.1 (W:1-55) Prokaryotic ribosomal protein L30 {Deinococcus radiodurans [TaxId: 1299]}
mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe

SCOPe Domain Coordinates for d3dllw1:

Click to download the PDB-style file with coordinates for d3dllw1.
(The format of our PDB-style files is described here.)

Timeline for d3dllw1: