SCOPe 2.05: Domain d3dllo1: 3dll O:5-98

Lineage for d3dllo1 (3dll O:5-98)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)
   automatically mapped to Pfam PF00829

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158938] (6 PDB entries)
   Uniprot Q9RY64 5-98

8. Domain d3dllo1: 3dll O:5-98 [157792]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR O:5-98
   complexed with mg, zld, zn

Details for d3dllo1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (O:) 50S ribosomal protein L21

SCOPe Domain Sequences for d3dllo1:

Sequence; same for both SEQRES and ATOM records:

>d3dllo1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

Timeline for d3dllo1:

• d3dllo1 first appeared in SCOP 1.75
  
• d3dllo1 appears in SCOPe 2.04
  
• d3dllo1 appears in SCOPe 2.06
  
• d3dllo1 appears in the current release, SCOPe 2.08