Lineage for d3dllh1 (3dll H:1-134)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313373Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 1313374Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 1313375Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 1313376Protein Ribosomal protein L14 [50195] (5 species)
  7. 1313379Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries)
    Uniprot Q9RXJ2 1-134
  8. 1313384Domain d3dllh1: 3dll H:1-134 [157785]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR H:1-134
    complexed with mg, zld, zn

Details for d3dllh1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (H:) 50S ribosomal protein L14

SCOPe Domain Sequences for d3dllh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllh1 b.39.1.1 (H:1-134) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]}
mimpqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaap
rgavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrd
rrfmkivslapevl

SCOPe Domain Coordinates for d3dllh1:

Click to download the PDB-style file with coordinates for d3dllh1.
(The format of our PDB-style files is described here.)

Timeline for d3dllh1: