Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) |
Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
Species Deinococcus radiodurans [TaxId:1299] [159475] (6 PDB entries) Uniprot Q9RXY1 30-171 |
Domain d3dllg1: 3dll G:30-171 [157784] Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1 automatically matched to 2ZJR G:30-171 complexed with mg, zld, zn |
PDB Entry: 3dll (more details), 3.5 Å
SCOPe Domain Sequences for d3dllg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dllg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]} ktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqva ltgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrlk vyagethphsaqkpqvlktqpl
Timeline for d3dllg1:
View in 3D Domains from other chains: (mouse over for more information) d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1 |