Lineage for d3dllb1 (3dll B:1-205)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544209Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 1544210Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 1544211Species Deinococcus radiodurans [TaxId:1299] [159160] (9 PDB entries)
    Uniprot Q9RXK2 1-205
  8. 1544219Domain d3dllb1: 3dll B:1-205 [157779]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR B:1-205
    complexed with mg, zld, zn

Details for d3dllb1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (B:) 50S ribosomal protein L3

SCOPe Domain Sequences for d3dllb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllb1 b.43.3.2 (B:1-205) Ribosomal protein L3 {Deinococcus radiodurans [TaxId: 1299]}
mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
lilvkgaipgangglvvlrsaakas

SCOPe Domain Coordinates for d3dllb1:

Click to download the PDB-style file with coordinates for d3dllb1.
(The format of our PDB-style files is described here.)

Timeline for d3dllb1: