SCOPe 2.08: Domain d3dika1: 3dik A:148-219

Lineage for d3dika1 (3dik A:148-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein HIV capsid protein, dimerisation domain [47359] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (13 PDB entries)

8. Domain d3dika1: 3dik A:148-219 [157751]
   Other proteins in same PDB: d3dika2
   automatically matched to d1e6jp1

Details for d3dika1

PDB Entry: 3dik

PDB Description: pseudo-atomic model of the hiv-1 ca hexameric lattice

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d3dika1:

Sequence; same for both SEQRES and ATOM records:

>d3dika1 a.28.3.1 (A:148-219) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacq

Timeline for d3dika1:

• d3dika1 first appeared in SCOP 1.75
  
• d3dika1 appears in SCOPe 2.07