Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) |
Protein automated matches [190376] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187223] (2 PDB entries) |
Domain d3didb_: 3did B: [157746] automated match to d1eta1_ complexed with act, gol, zn; mutant |
PDB Entry: 3did (more details), 1.78 Å
SCOPe Domain Sequences for d3didb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3didb_ b.3.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn
Timeline for d3didb_: