SCOPe 2.08: Domain d3dhwc1: 3dhw C:1-240

Lineage for d3dhwc1 (3dhw C:1-240)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Methionine import ATP-binding protein MetN [159571] (1 species)

7. Species Escherichia coli [TaxId:562] [159572] (2 PDB entries)
   Uniprot P30750 1-240

8. Domain d3dhwc1: 3dhw C:1-240 [157729]
   Other proteins in same PDB: d3dhwa1, d3dhwb1, d3dhwc2, d3dhwd2, d3dhwe1, d3dhwf1, d3dhwg2, d3dhwh2

Details for d3dhwc1

PDB Entry: 3dhw, 3.7 Å

PDB Description: Crystal structure of methionine importer MetNI

PDB Compounds: (C:) Methionine import ATP-binding protein metN

SCOPe Domain Sequences for d3dhwc1:

Sequence; same for both SEQRES and ATOM records:

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}
miklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpteg
svlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkrr
vtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdeatsaldpattrsil
ellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqkf

Timeline for d3dhwc1:

• d3dhwc1 first appeared in SCOP 1.75
  
• d3dhwc1 appears in SCOPe 2.07