SCOPe 2.05: Domain d3dhpa1: 3dhp A:409-496

Lineage for d3dhpa1 (3dhp A:409-496)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (30 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225771] (13 PDB entries)

8. Domain d3dhpa1: 3dhp A:409-496 [157725]
   Other proteins in same PDB: d3dhpa2
   automated match to d1jxka1
   complexed with ca, cl, glc, hmc

Details for d3dhpa1

PDB Entry: 3dhp, 1.5 Å

PDB Description: probing the role of aromatic residues at the secondary saccharide binding sites of human salivary alpha-amylase in substrate hydrolysis and bacterial binding

PDB Compounds: (A:) Alpha-amylase 1

SCOPe Domain Sequences for d3dhpa1:

Sequence; same for both SEQRES and ATOM records:

>d3dhpa1 b.71.1.0 (A:409-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

Timeline for d3dhpa1:

• d3dhpa1 first appeared in SCOP 1.75
  
• d3dhpa1 appears in SCOPe 2.04
  
• d3dhpa1 appears in SCOPe 2.06
  
• d3dhpa1 appears in the current release, SCOPe 2.08