SCOP 1.75: Domain d3dggc2: 3dgg C:111-215

Lineage for d3dggc2 (3dgg C:111-215)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
   SQ NA # humanized antibody
   Uniprot P01834 # KAC_HUMAN Ig kappa chain C region
   SQ P01834 # KAC_HUMAN Ig kappa chain C region.
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d3dggc2: 3dgg C:111-215 [157718]
   Other proteins in same PDB: d3dgga1, d3dggb1, d3dggc1, d3dggd1
   automatically matched to d1h3pl2
   complexed with mg

Details for d3dggc2

PDB Entry: 3dgg, 2.3 Å

PDB Description: crystal structure of fabox108

PDB Compounds: (C:) FabOX108 Light Chain Fragment

SCOP Domain Sequences for d3dggc2:

Sequence; same for both SEQRES and ATOM records:

>d3dggc2 b.1.1.2 (C:111-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d3dggc2:

• d3dggc2 is new in SCOP 1.75
  
• d3dggc2 appears in SCOPe 2.01
  
• d3dggc2 appears in the current release, SCOPe 2.08