SCOPe 2.07: Domain d3dggc1: 3dgg C:1-110

Lineage for d3dggc1 (3dgg C:1-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3dggc1: 3dgg C:1-110 [157717]
   Other proteins in same PDB: d3dgga2, d3dggb1, d3dggc2, d3dggd1
   automated match to d1a5fl1
   complexed with mg

Details for d3dggc1

PDB Entry: 3dgg, 2.3 Å

PDB Description: crystal structure of fabox108

PDB Compounds: (C:) FabOX108 Light Chain Fragment

SCOPe Domain Sequences for d3dggc1:

Sequence; same for both SEQRES and ATOM records:

>d3dggc1 b.1.1.0 (C:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspaslavslgqratiscrasksvstsgysymhwyqqkpgqppklliylasnles
gvparfsgsgsgtdftlnihpveeedaatyycqhsrelltfgagtklelk

Timeline for d3dggc1:

• d3dggc1 first appeared in SCOP 1.75
  
• d3dggc1 appears in SCOPe 2.06
  
• d3dggc1 appears in the current release, SCOPe 2.08